Shopping Cart
- Remove All
- Your shopping cart is currently empty
Dermaseptin-B4 is a potent antimicrobial peptide sourced from the skin secretions of the South American frog, Phyllomedusa bicolor [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Dermaseptin-B4 is a potent antimicrobial peptide sourced from the skin secretions of the South American frog, Phyllomedusa bicolor [1]. |
Molecular Weight | 2997.51 |
Formula | C133H226N38O38S |
Cas No. | 210890-56-5 |
Sequence | Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser-NH2 |
Sequence Short | ALWKDILKNVGKAAGKAVLNTVTDMVNQ-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.