Shopping Cart
- Remove All
- Your shopping cart is currently empty
Dendrotoxin K, a Kv1.1 channel blocker, modulates glutamate release in CA3 neurons by regulating the presynaptic spike waveform in a time-dependent manner [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Dendrotoxin K, a Kv1.1 channel blocker, modulates glutamate release in CA3 neurons by regulating the presynaptic spike waveform in a time-dependent manner [1]. |
Molecular Weight | 6559.66 |
Formula | C294H462N84O75S6 |
Cas No. | 119128-61-9 |
Sequence | Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Leu-Arg-Ile-Gly-Pro-Cys-Lys-Arg-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly (Disulfide bridge:Cys5-Cys5 |
Sequence Short | AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.