Shopping Cart
- Remove All
Your shopping cart is currently empty
Defensin HNP-3 human, a cytotoxic antibiotic peptide referred to as "defensin," exhibits inhibitory effects on Staphylococcus aureus, Pseudomonas aeruginosa, and Escherichia coli. This compound is first synthesized as a 94 amino acid chain known as preproHNP(1-94), then cleaved to proHNP(20-94), and finally matures into HNP(65-94) following the excision of anionic precursors [1] [2].

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Defensin HNP-3 human, a cytotoxic antibiotic peptide referred to as "defensin," exhibits inhibitory effects on Staphylococcus aureus, Pseudomonas aeruginosa, and Escherichia coli. This compound is first synthesized as a 94 amino acid chain known as preproHNP(1-94), then cleaved to proHNP(20-94), and finally matures into HNP(65-94) following the excision of anionic precursors [1] [2]. |
| Molecular Weight | 3486.04 |
| Formula | C151H222N44O40S6 |
| Cas No. | 136661-76-2 |
| Sequence | Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Sequence Short | DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.