Shopping Cart
- Remove All
- Your shopping cart is currently empty
CRAMP (mouse), an antimicrobial peptide, is utilized in the study of biofilm-associated infections [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | CRAMP (mouse), an antimicrobial peptide, is utilized in the study of biofilm-associated infections [1]. |
Molecular Weight | 3878.61 |
Formula | C178H302N50O46 |
Cas No. | 376364-36-2 |
Sequence | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
Sequence Short | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.