Shopping Cart
- Remove All
- Your shopping cart is currently empty
Big endothelin-1 (rat 1-39), a 39-residue peptide, induces diuretic and natriuretic responses in conscious Sprague-Dawley rats and elevates blood pressure in mice [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Big endothelin-1 (rat 1-39), a 39-residue peptide, induces diuretic and natriuretic responses in conscious Sprague-Dawley rats and elevates blood pressure in mice [1]. |
Cas No. | 135842-15-8 |
Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser |
Sequence Short | CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.