Shopping Cart
- Remove All
Your shopping cart is currently empty
ACTH (7-38) (human) is a fragment (7-38) of the full human adrenocorticotropic hormone (ACTH (1-39)), also known as corticotropin inhibitory peptide (CIP). It functions as an antagonist to the ACTH receptor and lacks corticosteroid activity [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | ACTH (7-38) (human) is a fragment (7-38) of the full human adrenocorticotropic hormone (ACTH (1-39)), also known as corticotropin inhibitory peptide (CIP). It functions as an antagonist to the ACTH receptor and lacks corticosteroid activity [1]. |
| Molecular Weight | 3659.11 |
| Formula | C167H257N47O46 |
| Cas No. | 68563-24-6 |
| Sequence | Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu |
| Sequence Short | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.