Shopping Cart
Remove All
Your shopping cart is currently empty
β-Amyloid (1-42), rat/mouse TFA is a 42-amino-acid polypeptide fragment that exhibits neurotoxicity to hippocampal slices and is commonly used to establish Alzheimer's disease models for related research.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $163 | - | In Stock | |
| 1 mg | $263 | - | In Stock | |
| 5 mg | $993 | - | In Stock |
| Description | β-Amyloid (1-42), rat/mouse TFA is a 42-amino-acid polypeptide fragment that exhibits neurotoxicity to hippocampal slices and is commonly used to establish Alzheimer's disease models for related research. |
| In vitro | β-Amyloid Aggregation Guidelines (This protocol provides only a guideline and should be modified according to your specific needs). Dissolve the solid Aβ peptide in cold hexafluoro-2-propanol (HFIP). Incubate the peptide at room temperature for at least 1 hour to establish monomerization and randomization of the structural formation.Evaporate HFIP to preserve the obtained peptide in a film form at -20 or -80°C.Dissolve the obtained film in anhydrous DMSO (5 mM) and then vortex to dilute it to an appropriate concentration in a buffer (serum-free and phenol red-free medium).Subsequently, age the solution at 4-8°C for 48 hours. Centrifuge the samples at 14,000 g for 10 minutes at 4-8°C; soluble oligomers will be present in the supernatant. Dilute the supernatant 10-200 times for experimental use.The method may vary based on downstream applications. |
| Synonyms | Amyloid β-peptide (1-42) (human) TFA, 166090-74-0 TFA |
| Molecular Weight | 4532.04 |
| Color | White |
| Appearance | Solid |
| Sequence | Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Sequence Short | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 50 mg/mL (11.03 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.