Your shopping cart is currently empty

β-Amyloid (1-42), rat/mouse TFA is a 42-amino-acid polypeptide fragment that exhibits neurotoxicity to hippocampal slices and is commonly used to establish Alzheimer's disease models for related research.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 500 μg | $163 | - | In Stock | |
| 1 mg | $263 | - | In Stock | |
| 5 mg | $993 | - | In Stock |
| Description | β-Amyloid (1-42), rat/mouse TFA is a 42-amino-acid polypeptide fragment that exhibits neurotoxicity to hippocampal slices and is commonly used to establish Alzheimer's disease models for related research. |
| In vitro | β-Amyloid Aggregation Guidelines (This protocol provides only a guideline and should be modified according to your specific needs). Dissolve the solid Aβ peptide in cold hexafluoro-2-propanol (HFIP). Incubate the peptide at room temperature for at least 1 hour to establish monomerization and randomization of the structural formation.Evaporate HFIP to preserve the obtained peptide in a film form at -20 or -80°C.Dissolve the obtained film in anhydrous DMSO (5 mM) and then vortex to dilute it to an appropriate concentration in a buffer (serum-free and phenol red-free medium).Subsequently, age the solution at 4-8°C for 48 hours. Centrifuge the samples at 14,000 g for 10 minutes at 4-8°C; soluble oligomers will be present in the supernatant. Dilute the supernatant 10-200 times for experimental use.The method may vary based on downstream applications. |
| Disease Modeling Protocol | Alzheimer's Disease (AD) Model
*Precautions: Execution and testing 14 days later |
| Synonyms | Amyloid β-peptide (1-42) (rat/mouse) TFA, 166090-74-0 TFA |
| Molecular Weight | 4532.04 |
| Sequence | Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Sequence Short | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 50 mg/mL (11.03 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.