Your shopping cart is currently empty

β-Amyloid (1-42), rat/mouse is a peptide composed of 42 amino acids that exerts significant neurotoxic effects on hippocampal slices, causing neuronal damage and functional impairment. It is commonly used to establish both in vitro and in vivo Alzheimer's disease models.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $1,680 | 35 days | 35 days |
| Description | β-Amyloid (1-42), rat/mouse is a peptide composed of 42 amino acids that exerts significant neurotoxic effects on hippocampal slices, causing neuronal damage and functional impairment. It is commonly used to establish both in vitro and in vivo Alzheimer's disease models. |
| Synonyms | β-Amyloid (1-42), rat, Amyloid β-peptide (1-42) (rat) |
| Molecular Weight | 4418.02 |
| Formula | C199H307N53O59S |
| Cas No. | 166090-74-0 |
| Relative Density. | 1.31g/cm3 |
| Sequence | Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Sequence Short | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Storage | keep away from moisture | Powder: -20°C for 3 years | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.