Shopping Cart
- Remove All
- Your shopping cart is currently empty
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is Q01227.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $129 | 20 days | |
10 μg | $216 | 20 days | |
20 μg | $360 | 20 days | |
50 μg | $543 | 20 days | |
100 μg | $745 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is Q01227. |
Species | VACV |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q01227 |
Synonyms | PS/HR,Protein OPG190,Plaque-size/host range protein,OPG190 |
Amino Acid | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
Construction | 18-279 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 33.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.