Vaccinia virus (strain Western Reserve) OPG190 Protein (His)

Name: Vaccinia virus (strain Western Reserve) OPG190 Protein (His)
Brand: TargetMol
SKU: TMPH-03669
Rating: 4.5 (1 reviews)

(Synonyms: PS/HR, Protein OPG190, Plaque-size/host range protein, OPG190) Copy Product Info

Synonyms: PS/HR, Protein OPG190, Plaque-size/host range protein, OPG190

Catalog No. TMPH-03669 Copy Product Info

Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q01227.

Vaccinia virus (strain Western Reserve) OPG190 Protein (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,190	20 days	20 days
500 μg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q01227.
Species	VACV
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q01227
Amino Acid	YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Construction	18-279 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	PS/HR, Protein OPG190, Plaque-size/host range protein, OPG190
Research Background

Chemical Properties

Molecular Weight

31.1 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Protein OPG 190OPG 190

Related Tags: Vaccinia virus (strain Western Reserve) OPG190 Protein (His) chemical structure | Vaccinia virus (strain Western Reserve) OPG190 Protein (His) molecular weight