Vaccinia virus (strain Lister) OPG190 Protein (His)

Catalog No. TMPH-03660

Regulation of plaque size and host range. Vaccinia virus (strain Lister) OPG190 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P24083.

Vaccinia virus (strain Lister) OPG190 Protein (His)

Catalog No. TMPH-03660

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$276	20 days	20 days
10 μg	$463	20 days	20 days
20 μg	$780	20 days	20 days
50 μg	$987	20 days	20 days
100 μg	$1,260	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Regulation of plaque size and host range. Vaccinia virus (strain Lister) OPG190 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P24083.
Species	VACV
Expression System	E. coli
Tag	N-6xHis
Accession Number	P24083
Synonyms	PS/HR,Protein OPG190,Plaque-size/host range protein,OPG190
Amino Acid	VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Construction	17-279 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	33.2 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Regulation of plaque size and host range.