Shopping Cart
- Remove All
Your shopping cart is currently empty
Regulation of plaque size and host range. Vaccinia virus (strain Lister) OPG190 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P24083.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $276 | 20 days | |
| 10 μg | $463 | 20 days | |
| 20 μg | $780 | 20 days | |
| 50 μg | $987 | 20 days | |
| 100 μg | $1,260 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Regulation of plaque size and host range. Vaccinia virus (strain Lister) OPG190 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P24083. |
| Species | VACV |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P24083 |
| Synonyms | PS/HR,Protein OPG190,Plaque-size/host range protein,OPG190 |
| Amino Acid | VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
| Construction | 17-279 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 33.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Regulation of plaque size and host range. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.