Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus (strain Copenhagen) OPG190 Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03667 Copy Product Info
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Vaccinia virus (strain Copenhagen) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is P21115.

Vaccinia virus (strain Copenhagen) OPG190 Protein (His)

Catalog No. TMPH-03667
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Vaccinia virus (strain Copenhagen) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is P21115.

Vaccinia virus (strain Copenhagen) OPG190 Protein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Vaccinia virus (strain Copenhagen) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is P21115.
Species
VACV
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP21115
Synonyms
PS/HR,Protein OPG190,Plaque-size/host range protein,OPG190
Amino Acid
YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Construction
18-279 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight31.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords