BTN3A1 Protein, Human, Recombinant (Yeast, His)

Name: BTN3A1 Protein, Human, Recombinant (Yeast, His)
Brand: TargetMol
SKU: TMPH-01020
Rating: 4.5 (1 reviews)

(Synonyms: CD277, Butyrophilin subfamily 3 member A1, BTN3A1, BTF5) Copy Product Info

Synonyms: CD277, Butyrophilin subfamily 3 member A1, BTN3A1, BTF5

Catalog No. TMPH-01020 Copy Product Info

Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. BTN3A1 Protein, Human, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.2 kDa and the accession number is O00481.

BTN3A1 Protein, Human, Recombinant (Yeast, His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$231	20 days	20 days
50 µg	$348	20 days	20 days
100 µg	$480	20 days	20 days
200 µg	$743	20 days	20 days
500 µg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. BTN3A1 Protein, Human, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.2 kDa and the accession number is O00481.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	O00481
Amino Acid	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Construction	30-254 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	CD277, Butyrophilin subfamily 3 member A1, BTN3A1, BTF5
Research Background	Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.

Chemical Properties

Molecular Weight

26.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.