Your shopping cart is currently empty

TpD is a chimeric T-helper epitope that features a specific site for cleavage by caspases. Immunization with TpD induces a strong antibody response and enhances long-term CD4 immune reactions in both animals and humans. It effectively binds to various human MHCII types, primarily HLA-DRB1, and also interacts with other HLA alleles, including DRB3, DRB4, DRB5, DP, and DQ. TpD can be utilized to amplify the immune response in peptide vaccines.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | TpD is a chimeric T-helper epitope that features a specific site for cleavage by caspases. Immunization with TpD induces a strong antibody response and enhances long-term CD4 immune reactions in both animals and humans. It effectively binds to various human MHCII types, primarily HLA-DRB1, and also interacts with other HLA alleles, including DRB3, DRB4, DRB5, DP, and DQ. TpD can be utilized to amplify the immune response in peptide vaccines. |
| Molecular Weight | 3464.21 |
| Formula | C158H264N38O42S3 |
| Cas No. | 1273551-45-3 |
| Smiles | C([C@@H](NC(CNC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]([C@H](CC)C)N)=O)CC(C)C)=O)CCSC)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CCCCN)=O)C)=O)CC(N)=O)=O)CO)=O)CCCCN)=O)=O)[C@H](CC)C)=O)=O)[C@H](CC)C)(=O)N3[C@H](C(N[C@H](C(NCC(N[C@H](C(=O)N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(O)=O)=O)C)=O)C(C)C)=O)CCSC)=O)CC(C)C)=O)CO)=O)CO)=O)CC(C)C)=O)C)=O)[C@H](CC)C)=O)CO)=O)CCC(N)=O)=O)CCC4)CC(C)C)=O)=O)CCSC)=O)CCC3 |
| Sequence | Ile-Leu-Met-Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Pro-Met-Gly-Leu-Pro-Gln-Ser-Ile-Ala-Leu-Ser-Ser-Leu-Met-Val-Ala-Gln |
| Sequence Short | ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.