Your shopping cart is currently empty

Tat-peptide 168-189, a cell-permeable, Tat-labeled fusion peptide derived from residues 168-189 of rat G3BP1, features the HIV Tat sequence at its least conserved terminus to enhance cellular uptake. It serves as the negative control for Tat-peptide 168-189 TFA, which promotes axon growth and neurite proliferation [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-peptide 168-189, a cell-permeable, Tat-labeled fusion peptide derived from residues 168-189 of rat G3BP1, features the HIV Tat sequence at its least conserved terminus to enhance cellular uptake. It serves as the negative control for Tat-peptide 168-189 TFA, which promotes axon growth and neurite proliferation [1]. |
| In vitro | Tat-peptide 168-189 TFA at concentrations of 10 μM and 20 μM administered for 24 hours enhanced axonal length in isolated DRG cultures by 10 μM and in iMotor neurons by 20 μM [1]. Additionally, a concentration of 10 μM of Tat-peptide 168-189 TFA applied for 3 days increased the total number of axons extending from each neuron [1]. |
| Molecular Weight | 4030.99 |
| Formula | C162H239N47O65S.C2HF3O2 |
| Sequence | Asp-Asp-Ser-Gly-Thr-Phe-Tyr-Asp-Gln-Ala-Val-Val-Ser-Asn-Asp-Met-Glu-Glu-His-Leu-Glu-Glu-Pro-Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn |
| Sequence Short | DDSGTFYDQAVVSNDMEEHLEEPYGNKKNNQNNN |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.