Your shopping cart is currently empty

Tat-peptide 168-189 is a cell-permeable Tat-tagged fusion peptide corresponding to residues 168-189 of rat G3BP1. The Tat sequence from HIV is incorporated at the least conserved end of this sequence to enhance cellular permeability. Serving as a negative control for Tat-peptide 190-208, Tat-peptide 168-189 contrasts with Tat-peptide 190-208, which promotes axon growth and increases the number of neurites per neuron.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-peptide 168-189 is a cell-permeable Tat-tagged fusion peptide corresponding to residues 168-189 of rat G3BP1. The Tat sequence from HIV is incorporated at the least conserved end of this sequence to enhance cellular permeability. Serving as a negative control for Tat-peptide 190-208, Tat-peptide 168-189 contrasts with Tat-peptide 190-208, which promotes axon growth and increases the number of neurites per neuron. |
| Formula | C162H239N47O65S |
| Sequence | Asp-Asp-Ser-Gly-Thr-Phe-Tyr-Asp-Gln-Ala-Val-Val-Ser-Asn-Asp-Met-Glu-Glu-His-Leu-Glu-Glu-Pro-Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn |
| Sequence Short | DDSGTFYDQAVVSNDMEEHLEEPYGNKKNNQNNN |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.