Shopping Cart
- Remove All
- Your shopping cart is currently empty
TAT-NSF700 Fusion Peptide acetate is a membrane-permeable inhibitor of N-ethyl-maleimide-sensitive factor (NSF), a fusion peptide with potential anti-inflammatory activity.TAT-NSF700 Fusion Peptide acetate interacts with intracellular organelles and can be used to investigate Myocardial ischemia and reperfusion injury.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $168 | In Stock | |
5 mg | $426 | In Stock | |
10 mg | $628 | In Stock | |
25 mg | $982 | In Stock | |
50 mg | $1,350 | In Stock | |
100 mg | $1,820 | In Stock |
Description | TAT-NSF700 Fusion Peptide acetate is a membrane-permeable inhibitor of N-ethyl-maleimide-sensitive factor (NSF), a fusion peptide with potential anti-inflammatory activity.TAT-NSF700 Fusion Peptide acetate interacts with intracellular organelles and can be used to investigate Myocardial ischemia and reperfusion injury. |
Color | White |
Appearance | Solid |
Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Leu-Asp-Tyr-Val-Pro-Ile-Gly-Pro-Arg-Phe-Ser-Asn-Leu-Val-Leu-Gln-Ala-Leu-Leu-Val-Leu |
Sequence Short | YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.