Shopping Cart
- Remove All
Your shopping cart is currently empty
Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) represents truncated fragments of the parent peptide, characterized by an N-terminal fluorescent label (Fitc).
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) represents truncated fragments of the parent peptide, characterized by an N-terminal fluorescent label (Fitc). |
| Molecular Weight | 3486.06 |
| Formula | C159H250N50O37S |
| Sequence | FITC--Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys |
| Sequence Short | FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.