Shopping Cart
- Remove All
- Your shopping cart is currently empty
Secretoneurin, rat acetate is a 33-amino acid polypeptide generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat acetate induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $89 | In Stock | |
5 mg | $202 | In Stock | |
10 mg | $298 | In Stock | |
25 mg | $476 | In Stock | |
50 mg | $678 | In Stock | |
100 mg | $912 | In Stock | |
200 mg | $1,190 | In Stock |
Description | Secretoneurin, rat acetate is a 33-amino acid polypeptide generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat acetate induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes. |
Synonyms | Secretoneurin, rat acetate(149146-12-3 Free base) |
Relative Density. | no data available |
Sequence | Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln.CH3CO2H |
Sequence Short | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.