Shopping Cart
Remove All
Your shopping cart is currently empty
RGHRH (1-29)NH2 is a synthetic peptide that stimulates the secretion of growth hormone (GH).
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $108 | Inquiry | Inquiry | |
| 5 mg | $216 | Inquiry | Inquiry | |
| 10 mg | $346 | Inquiry | Inquiry | |
| 25 mg | $742 | Inquiry | Inquiry |
| Description | RGHRH (1-29)NH2 is a synthetic peptide that stimulates the secretion of growth hormone (GH). |
| Molecular Weight | 3473.02 |
| Formula | C155H251N49O40S |
| Relative Density. | no data available |
| Sequence | His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2 |
| Sequence Short | HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (14.4 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.