Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

S27 protein acetate (Synonyms: LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR)

Catalog No. TP2516 Copy Product Info
Purity: 97.78%
🥰Excellent
S27 protein acetate is a polypeptide encoded by the MRPS27 gene.

S27 protein acetate

Copy Product Info
🥰Excellent
Catalog No. TP2516
Synonyms LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR

S27 protein acetate is a polypeptide encoded by the MRPS27 gene.

S27 protein acetate
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
1 mg$195-In Stock
5 mg$483-In Stock
10 mg$692-In Stock
25 mg$1,080-In Stock
50 mg$1,490-In Stock
100 mg$1,970-In Stock
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Batch Information

Select Batch
Purity:97.78%
Appearance:Solid
Color:White
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
S27 protein acetate is a polypeptide encoded by the MRPS27 gene.
SynonymsLLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR
Chemical Properties
SequenceLeuLeuGlnLeuSerGluProProValSerGluLeuAspGlnLeuThrTyrAsnAsnThrMetPheThrAsnAsnLysIleThrThrSerHisThrAlaThrProArgGluPheArg
Sequence ShortLLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR
Storage & Solubility Information
Storagestore at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
DMSO: 100 mg/mL, Sonication is recommended.
H2O: < 1 mg/mL (insoluble or slightly soluble)

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: buy S27 protein acetate | purchase S27 protein acetate | S27 protein acetate cost | order S27 protein acetate