Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human β-defensin-2 (HβD-2) is a cationic skin-antimicrobial peptide (SAP) characterized by its small size and rich cysteine content. Produced by various epithelial cells, it exhibits potent antimicrobial properties against gram-negative bacteria and Candida but is not effective against gram-positive Staphylococcus aureus. Given these characteristics, Human β-defensin-2 serves as a valuable tool in colitis research.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Human β-defensin-2 (HβD-2) is a cationic skin-antimicrobial peptide (SAP) characterized by its small size and rich cysteine content. Produced by various epithelial cells, it exhibits potent antimicrobial properties against gram-negative bacteria and Candida but is not effective against gram-positive Staphylococcus aureus. Given these characteristics, Human β-defensin-2 serves as a valuable tool in colitis research. |
Alias | HβD-2, Human β-defensin-2 |
Cas No. | 372146-20-8 |
Relative Density. | no data available |
Sequence | Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
Sequence Short | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.