Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human β-defensin-1 (HβD-1) is a cysteine-rich, cationic skin antimicrobial peptide (SAP) produced by epithelial surfaces, circulatory cells, and cells of the reproductive tract, exhibiting antimicrobial activity against a broad spectrum of sperm-related bacteria.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Human β-defensin-1 (HβD-1) is a cysteine-rich, cationic skin antimicrobial peptide (SAP) produced by epithelial surfaces, circulatory cells, and cells of the reproductive tract, exhibiting antimicrobial activity against a broad spectrum of sperm-related bacteria. |
Alias | HβD-1, Human β-defensin-1 |
Cas No. | 452274-53-2 |
Sequence | Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
Sequence Short | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.