Your shopping cart is currently empty

Human β-defensin-1 (HβD-1) is a cysteine-rich, cationic skin antimicrobial peptide (SAP) produced by epithelial surfaces, circulatory cells, and cells of the reproductive tract, exhibiting antimicrobial activity against a broad spectrum of sperm-related bacteria.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | Human β-defensin-1 (HβD-1) is a cysteine-rich, cationic skin antimicrobial peptide (SAP) produced by epithelial surfaces, circulatory cells, and cells of the reproductive tract, exhibiting antimicrobial activity against a broad spectrum of sperm-related bacteria. |
| Synonyms | HβD-1, Human β-defensin-1 |
| Cas No. | 452274-53-2 |
| Sequence | Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
| Sequence Short | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.