Shopping Cart
- Remove All
- Your shopping cart is currently empty
Bovine Growth Hormone-Releasing Factor (bGRF(1-44)-NH2), commonly referred to as bovine GHRF, is a compound that stimulates the release of bovine growth hormone (GH). It has been found to exhibit a synergistic effect when combined with Hydrocortisone, enhancing its efficacy in promoting GH release [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Bovine Growth Hormone-Releasing Factor (bGRF(1-44)-NH2), commonly referred to as bovine GHRF, is a compound that stimulates the release of bovine growth hormone (GH). It has been found to exhibit a synergistic effect when combined with Hydrocortisone, enhancing its efficacy in promoting GH release [1] [2]. |
Molecular Weight | 5104.72 |
Formula | C220H366N72O66S |
Cas No. | 88894-91-1 |
Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.