Your shopping cart is currently empty

DPc10 is a bioactive peptide. [It represents the amino acid segment 2460 to 2495 of the cardiac ryanodine receptor (RyR2). RyR2 is responsible for regulating calcium release from the sarcoplasmic reticulum, which initiates muscle contraction. Mutations in RyR2 are associated with ventricular tachycardia (VT) and sudden death.]
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | DPc10 is a bioactive peptide. [It represents the amino acid segment 2460 to 2495 of the cardiac ryanodine receptor (RyR2). RyR2 is responsible for regulating calcium release from the sarcoplasmic reticulum, which initiates muscle contraction. Mutations in RyR2 are associated with ventricular tachycardia (VT) and sudden death.] |
| Formula | C194H293N45O49S2 |
| Sequence | Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro |
| Sequence Short | GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.