Shopping Cart
- Remove All
- Your shopping cart is currently empty
Crotalicidin, obtained from rattlesnake venom, is both an antimicrobial and anti-tumor peptide with potent efficacy against Gram-negative bacteria and cancerous cells, showing promise for research in microbial infections and oncology [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Crotalicidin, obtained from rattlesnake venom, is both an antimicrobial and anti-tumor peptide with potent efficacy against Gram-negative bacteria and cancerous cells, showing promise for research in microbial infections and oncology [1]. |
Molecular Weight | 4151.32 |
Formula | C203H346N54O36S |
Cas No. | 1818372-26-7 |
Sequence | Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Val-Lys-Lys-Ser-Val-Lys-Lys-Arg-Leu-Lys-Lys-Ile-Phe-Lys-Lys-Pro-Met-Val-Ile-Gly-Val-Thr-Ile-Pro-Phe-NH2 |
Sequence Short | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.