Shopping Cart

Remove All
Your shopping cart is currently empty

Bovine neutrophil beta-defensin 12

Name: Bovine neutrophil beta-defensin 12
Brand: TargetMol
SKU: T80323
Rating: 4.5 (1 reviews)

😃Good

Catalog No. T80323Cas No. 455257-02-0

Alias BNBD-12

Bovine neutrophil beta-defensin 12, an antimicrobial peptide originating from bovine neutrophils, exhibits antibacterial properties against Escherichia coli and Staphylococcus aureus [1].

Bovine neutrophil beta-defensin 12

😃Good

Catalog No. T80323Alias BNBD-12Cas No. 455257-02-0

Bovine neutrophil beta-defensin 12, an antimicrobial peptide originating from bovine neutrophils, exhibits antibacterial properties against Escherichia coli and Staphylococcus aureus [1].

Pack Size	Price	Availability	Quantity
5 mg	Inquiry	Backorder
50 mg	Inquiry	Backorder

Bulk & Custom

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description	Bovine neutrophil beta-defensin 12, an antimicrobial peptide originating from bovine neutrophils, exhibits antibacterial properties against Escherichia coli and Staphylococcus aureus [1].
Alias	BNBD-12

Chemical Properties

Molecular Weight	4099.9
Formula	C₁₇₄H₂₈₁N₅₇O₄₄S₇
Cas No.	455257-02-0
Sequence	Gly-Pro-Leu-Ser-Cys-Gly-Arg-Asn-Gly-Gly-Val-Cys-Ile-Pro-Ile-Arg-Cys-Pro-Val-Pro-Met-Arg-Gln-Ile-Gly-Thr-Cys-Phe-Gly-Arg-Pro-Val-Lys-Cys-Cys-Arg-Ser-Trp (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)
Sequence Short	GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW (Disulfide bridge:Cys5-Cys34;Cys12-Cys27;Cys17-Cys35)

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: buy Bovine neutrophil beta-defensin 12 | purchase Bovine neutrophil beta-defensin 12 | Bovine neutrophil beta-defensin 12 cost | order Bovine neutrophil beta-defensin 12 | Bovine neutrophil beta-defensin 12 formula | Bovine neutrophil beta-defensin 12 molecular weight