Your shopping cart is currently empty

BigGastrinI, human (TFA), is a gastrointestinal hormone comprised of 34 amino acids. It can serve as a potential substance in the study of conditions such as cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological disorders, or cardiovascular diseases.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | BigGastrinI, human (TFA), is a gastrointestinal hormone comprised of 34 amino acids. It can serve as a potential substance in the study of conditions such as cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological disorders, or cardiovascular diseases. |
| In vitro | Big Gastrin I, human (TFA) (10 μg/mL, 6 days) reduces HBV replication by 11.3% in HepG2 cells carrying the hepatitis B virus (HBV) ayw strain genome, while preserving cell viability at 88.7%. In addition, at the same concentration for 24 hours, it can induce cell cycle arrest in the G0/G1 phase and trigger apoptosis in human A549 cells. Furthermore, treatment with 10 μg/mL for 22 hours inhibits 35% of cell migration in human endothelial cells (HUVEC). |
| Formula | C178H252F3 |
| Sequence | Gly-Leu-Pro-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe |
| Sequence Short | {Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.