Shopping Cart
Remove All
Your shopping cart is currently empty
Member of the neurotrophin growth factor family that binds and activates TrkB and p75 neurotrophin receptors. Enhances the survival, growth and differentiation of neurons. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 μg | $1,530 | 35 days | 35 days |
| Description | Member of the neurotrophin growth factor family that binds and activates TrkB and p75 neurotrophin receptors. Enhances the survival, growth and differentiation of neurons. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease. |
| Molecular Weight | 26984 |
| Formula | NA |
| Cas No. | 218441-99-7 |
| Relative Density. | no data available |
| Sequence | His-Ser-Asp-Pro-Ala-Arg-Arg-Gly-Glu-Leu-Ser-Val-Cys-Asp-Ser-Ile-Ser-Glu-Trp-Val-Thr-Ala-Ala-Asp-Lys-Lys-Thr-Ala-Val-Asp-Met-Ser-Gly-Gly-Thr-Val-Thr-Val-Leu-Glu-Lys-Val-Pro-Val-Ser-Lys-Gly-Gln-Leu-Lys-Gln-Tyr-Phe-Tyr-Glu-Thr-Lys-Cys-Asn-Pro-Met-Gly-Tyr-Thr-Lys-Glu-Gly-Cys-Arg-Gly-Ile-Asp-Lys-Arg-His-Trp-Asn-Ser-Gln-Cys-Arg-Thr-Thr-Gln-Ser-Tyr-Val-Arg-Ala-Leu-Thr-Met-Asp-Ser-Lys-Lys-Arg-Ile-Gly-Trp-Arg-Phe-Ile-Arg-Ile-Asp-Thr-Ser-Cys-Val-Cys-Thr-Leu-Thr-Ile-Lys-Arg-Gly-Arg |
| Sequence Short | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.