Shopping Cart
- Remove All
- Your shopping cart is currently empty
[K15,R16,L27]VIP(1-7)/GRF(8-27), a selective agonist for the VIP 1 receptor, demonstrates binding IC50 values of 2 nM for the human VIP 1, 1 nM for the rat VIP 1, and 30,000 nM for the rat VIP 2 receptors, respectively [1]. VIP stands for VASOACTIVE Intestinal Polypeptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | [K15,R16,L27]VIP(1-7)/GRF(8-27), a selective agonist for the VIP 1 receptor, demonstrates binding IC50 values of 2 nM for the human VIP 1, 1 nM for the rat VIP 1, and 30,000 nM for the rat VIP 2 receptors, respectively [1]. VIP stands for VASOACTIVE Intestinal Polypeptide. |
Molecular Weight | 3171.7 |
Formula | C142H240N44O38 |
Cas No. | 201995-58-6 |
Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 |
Sequence Short | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.