Shopping Cart
- Remove All
- Your shopping cart is currently empty
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is an acetate salt form of the peptide [K15,R16,L27]VIP(1-7)/GRF(8-27), acting as a selective agonist for the VIP 1 receptor with IC50 values of 2 nM for human VIP 1, 1 nM for rat VIP 1, and 30,000 nM for rat VIP 2 receptors. The peptide's acronym, VIP, stands for Vasoactive Intestinal Polypeptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is an acetate salt form of the peptide [K15,R16,L27]VIP(1-7)/GRF(8-27), acting as a selective agonist for the VIP 1 receptor with IC50 values of 2 nM for human VIP 1, 1 nM for rat VIP 1, and 30,000 nM for rat VIP 2 receptors. The peptide's acronym, VIP, stands for Vasoactive Intestinal Polypeptide. |
Molecular Weight | 3171.70 (free base) |
Formula | C142H240N44O38.xC2H4O2 |
Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 |
Sequence Short | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.