Shopping Cart
- Remove All
- Your shopping cart is currently empty
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. TFPI Protein, Rabbit, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 35.4 kDa and the accession number is P19761.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $89 | 20 days | |
10 μg | $143 | 20 days | |
20 μg | $237 | 20 days | |
50 μg | $343 | 20 days | |
100 μg | $457 | 20 days | |
200 μg | $818 | 20 days | |
500 μg | $1,780 | 20 days | |
1 mg | $3,230 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC 50 is 2.281-3.783 ng/mL. |
Description | Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. TFPI Protein, Rabbit, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 35.4 kDa and the accession number is P19761. |
Species | Rabbit |
Expression System | HEK293 Cells |
Tag | N-10xHis |
Accession Number | P19761 |
Synonyms | Tissue factor pathway inhibitor,TFPI,Lipoprotein-associated coagulation inhibitor (LACI),Extrinsic pathway inhibitor (EPI) |
Amino Acid | AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT |
Construction | 25-300 aa |
Protein Purity | > 95% as determined by SDS-PAGE. |
Molecular Weight | 35.4 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.