TFPI Protein, Rabbit, Recombinant (His)

Name: TFPI Protein, Rabbit, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03211
Rating: 4.5 (1 reviews)

(Synonyms: Tissue factor pathway inhibitor, TFPI, Lipoprotein-associated coagulation inhibitor (LACI), Extrinsic pathway inhibitor (EPI)) Copy Product Info

Synonyms: Tissue factor pathway inhibitor, TFPI, Lipoprotein-associated coagulation inhibitor (LACI), Extrinsic pathway inhibitor (EPI)

Catalog No. TMPH-03211 Copy Product Info

Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. TFPI Protein, Rabbit, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 35.4 kDa and the accession number is P19761.

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	20 days	20 days
50 µg	$343	20 days	20 days
100 µg	$457	20 days	20 days
200 µg	$818	20 days	20 days
500 µg	$1,780	20 days	20 days
1 mg	$3,230	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC 50 is 2.281-3.783 ng/mL.
Description	Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. TFPI Protein, Rabbit, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 35.4 kDa and the accession number is P19761.
Species	Rabbit
Expression System	HEK293 Cells
Tag	N-10xHis
Accession Number	P19761
Amino Acid	AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Construction	25-300 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Tissue factor pathway inhibitor, TFPI, Lipoprotein-associated coagulation inhibitor (LACI), Extrinsic pathway inhibitor (EPI)
Research Background	Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Chemical Properties

Molecular Weight

35.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.