Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-4 Protein, Mesocricetus auratus, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02457

IL-4 Protein, Mesocricetus auratus, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q60440.

IL-4 Protein, Mesocricetus auratus, Recombinant (His)

IL-4 Protein, Mesocricetus auratus, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02457
IL-4 Protein, Mesocricetus auratus, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q60440.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$9520 days20 days
10 μg$15520 days20 days
20 μg$25620 days20 days
50 μg$38620 days20 days
100 μg$52820 days20 days
200 μg$81720 days20 days
500 μg$1,46020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IL-4 Protein, Mesocricetus auratus, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q60440.
Species
Mesocricetus auratus
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberQ60440
Synonyms
Lymphocyte stimulatory factor 1,Interleukin-4,IL-4,IL4,B-cell stimulatory factor 1 (BSF-1)
Amino Acid
NWTLGCHHGALKEIIHILNQVTEKGTPCTEMVVPDALSARKNSTEKDLICRASQGFRKFYFQHEVTLCLKNNSRVLKDLKKLYRGISSLFPQKSCNVNESTYTTLKDFLESLRRIMQKKYWQCGSSTF
Construction
20-147 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight16.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords