IL-1F10 Protein, Mouse, Recombinant (His & SUMO)

Name: IL-1F10 Protein, Mouse, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-02737
Rating: 4.5 (1 reviews)

(Synonyms: Interleukin-1 family member 10, IL-1F10, Il1f10) Copy Product Info

Synonyms: Interleukin-1 family member 10, IL-1F10, Il1f10

Catalog No. TMPH-02737 Copy Product Info

IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$987	20 days	20 days
500 µg	$1,620	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q8R459
Amino Acid	MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Construction	1-152 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Interleukin-1 family member 10, IL-1F10, Il1f10
Research Background	Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.

Chemical Properties

Molecular Weight

33.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.