Home Tools
Log in
Cart

IL-13 Protein, Equus caballus, Recombinant (His)

Catalog No. TMPH-00551

IL-13 Protein, Equus caballus, Recombinant (His) is expressed in Yeast.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
IL-13 Protein, Equus caballus, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 769.00
1 mg 20 days $ 2,760.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description IL-13 Protein, Equus caballus, Recombinant (His) is expressed in Yeast.
Species Horse
Expression System P. pastoris (Yeast)
Tag C-6xHis
Accession Number B6C802
Amino Acid APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA
Construction 21-133 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 13.9 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol