Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IBV (strain D1466) Nucleoprotein/NP Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00141 Copy Product Info
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain D1466) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is Q9J4A3.

IBV (strain D1466) Nucleoprotein/NP Protein (His)

Catalog No. TMPH-00141
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain D1466) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is Q9J4A3.

IBV (strain D1466) Nucleoprotein/NP Protein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain D1466) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is Q9J4A3.
Species
IBV
Expression System
E. coli
TagC-6xHis
Accession NumberQ9J4A3
Synonyms
Nucleoprotein,Nucleocapsid protein (NC;Protein N)
Amino Acid
MASGKTTGKTDAPAPVIKLGGPKPPKVGSSGNASWFQALKAKKLNSPPPKFEGSGVPDNENLKLSQQHGYWRRQARYKPGKGGRKSVPDAWYFYYTGTGPAADLNWGYSQDGIVWVSAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPINRGRSGRSTAASSAASSRAPSRDGSRGRRSGAEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKCKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLRFEFTTVVSRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRPNSRPATRTSSPAPRQQPQKKEKKSKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGESALGENEL
Construction
1-409 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight46.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords