Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain D1466) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is Q9J4A3.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain D1466) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is Q9J4A3. |
Species | IBV |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | Q9J4A3 |
Amino Acid | MASGKTTGKTDAPAPVIKLGGPKPPKVGSSGNASWFQALKAKKLNSPPPKFEGSGVPDNENLKLSQQHGYWRRQARYKPGKGGRKSVPDAWYFYYTGTGPAADLNWGYSQDGIVWVSAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPINRGRSGRSTAASSAASSRAPSRDGSRGRRSGAEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKCKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLRFEFTTVVSRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRPNSRPATRTSSPAPRQQPQKKEKKSKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGESALGENEL |
Construction | 1-409 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 46.1 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein