Home Tools
Log in
Cart

IBV (strain Beaudette CK) Nucleoprotein/NP Protein (His)

Catalog No. TMPH-00136

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain Beaudette CK) Nucleoprotein/NP Protein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 47.2 kDa and the accession number is P69597.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
IBV (strain Beaudette CK) Nucleoprotein/NP Protein (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 614.00
100 μg 20 days $ 1,720.00
1 mg 20 days $ 7,240.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. IBV (strain Beaudette CK) Nucleoprotein/NP Protein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 47.2 kDa and the accession number is P69597.
Species IBV
Expression System HEK293 Cells
Tag C-6xHis
Accession Number P69597
Amino Acid MASGKAAGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNTPPPKFEGSGVPDNENIKPSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAADLNWGDTQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAPSREGSRGRRSDSGDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLHLRFEFTTVVPCDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRGNSPAPRQQRPKKEKKLKKQDDEADKALTSDEERNNAQLEFYDEPKVINWGDAALGENEL
Construction 1-409 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 47.2 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol