Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-2 Protein, Chicken, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00368 Copy Product Info
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. FGF-2 Protein, Chicken, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P48800.

FGF-2 Protein, Chicken, Recombinant (His)

Catalog No. TMPH-00368
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. FGF-2 Protein, Chicken, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P48800.

FGF-2 Protein, Chicken, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$9520 days20 days
10 μg$15520 days20 days
20 μg$256-In Stock
50 μg$38620 days20 days
100 μg$52820 days20 days
200 μg$81720 days20 days
500 μg$1,46020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. FGF-2 Protein, Chicken, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P48800.
Species
Chicken
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP48800
Synonyms
Heparin-binding growth factor 2 (HBGF-2),Fibroblast growth factor 2,FGF-2,FGF2,Basic fibroblast growth factor (bFGF)
Amino Acid
PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
Construction
13-158 aa
Protein Purity
> 90% as determined by SDS-PAGE.
FGF-2 Protein, Chicken, Recombinant (His)
Molecular Weight18.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords