CEACAM5 Protein, Human, Recombinant (E398K, His)

Name: CEACAM5 Protein, Human, Recombinant (E398K, His)
Brand: TargetMol
SKU: TMPH-01048
Price: 44 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Meconium antigen 100, Cell adhesion molecule CEACAM5, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA cell adhesion molecule 5), Carcinoembryonic antigen (CEA)) Copy Product Info

Synonyms: Meconium antigen 100, Cell adhesion molecule CEACAM5, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA cell adhesion molecule 5), Carcinoembryonic antigen (CEA)

Catalog No. TMPH-01048 Copy Product Info

CEACAM5 Protein, Human, Recombinant (E398K, His) is expressed in HEK293 Cells. The accession number is P06731.

Pack Size	Price	USA Stock	Global Stock
5 µg	$44	-	In Stock
10 µg	$68	12 days	12 days
20 µg	$108	-	In Stock
50 µg	$189	12 days	12 days
100 µg	$299	12 days	12 days
200 µg	$538	12 days	12 days
500 µg	$1,190	12 days	12 days
1 mg	$2,180	12 days	12 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:99% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody, the EC50 is 0.8955-1.719 ng/mL.
Description	CEACAM5 Protein, Human, Recombinant (E398K, His) is expressed in HEK293 Cells. The accession number is P06731.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P06731
Amino Acid	KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Construction	35-685 aa (E398K)
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Meconium antigen 100, Cell adhesion molecule CEACAM5, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA cell adhesion molecule 5), Carcinoembryonic antigen (CEA)
Research Background	Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.; (Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.

Chemical Properties

Molecular Weight

74.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.