Shopping Cart
Remove All
Your shopping cart is currently empty
CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $48 | 20 days | 20 days | |
| 10 μg | $75 | 20 days | 20 days | |
| 20 μg | $118 | 20 days | 20 days | |
| 50 μg | $229 | 20 days | 20 days | |
| 100 μg | $386 | 20 days | 20 days | |
| 200 μg | $682 | 20 days | 20 days | |
| 500 μg | $1,430 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml. |
| Description | CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P09326 |
| Synonyms | SLAMF2,MEM-102,mCD48,hCD48,CD48 molecule,Blast-1,BLAST1,BLAST,BCM1 |
| Amino Acid | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Construction | 27-220 aa |
| Protein Purity | > 90% as determined by SDS-PAGE |
| Molecular Weight | 51.3 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.