Shopping Cart
Remove All
Your shopping cart is currently empty
CD48 Protein, Human, Recombinant (hFc) V2
(Synonyms: SLAMF2, MEM-102, mCD48, hCD48, CD48 molecule, Blast-1, BLAST1, BLAST, BCM1) Copy Product InfoSynonyms: SLAMF2, MEM-102, mCD48, hCD48, CD48 molecule, Blast-1, BLAST1, BLAST, BCM1
Catalog No. TMPY-03947U Copy Product Info
CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $48 | 20 days | 20 days | |
| 10 μg | $75 | 20 days | 20 days | |
| 20 μg | $118 | 20 days | 20 days | |
| 50 μg | $229 | 20 days | 20 days | |
| 100 μg | $386 | 20 days | 20 days | |
| 200 μg | $682 | 20 days | 20 days | |
| 500 μg | $1,430 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml. |
| Description | CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P09326 |
| Amino Acid | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Construction | 27-220 aa |
| Protein Purity | > 90% as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | SLAMF2, MEM-102, mCD48, hCD48, CD48 molecule, Blast-1, BLAST1, BLAST, BCM1 |
| Molecular Weight | 51.3 kDa (Predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: CD48 Protein, Human, Recombinant (hFc) V2 chemical structure | CD48 Protein, Human, Recombinant (hFc) V2 molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.