Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CD48 Protein, Human, Recombinant (hFc) V2

TargetMol | SPR
Catalog No. TMPY-03947U Copy Product Info
CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.

CD48 Protein, Human, Recombinant (hFc) V2

Catalog No. TMPY-03947U
Copy Product Info
TargetMol | SPR

CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.

CD48 Protein, Human, Recombinant (hFc) V2
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$4820 days20 days
10 μg$7520 days20 days
20 μg$11820 days20 days
50 μg$22920 days20 days
100 μg$38620 days20 days
200 μg$68220 days20 days
500 μg$1,43020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.
Description
CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP09326
Synonyms
SLAMF2,MEM-102,mCD48,hCD48,CD48 molecule,Blast-1,BLAST1,BLAST,BCM1
Amino Acid
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Construction
27-220 aa
Protein Purity
> 90% as determined by SDS-PAGE
Molecular Weight51.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords