Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.

CD48 Protein, Human, Recombinant (hFc) V2 is expressed in HEK293 Cells. The accession number is P09326.

Human

HEK293 Cells

SLAMF2,MEM-102,mCD48,hCD48,CD48 molecule,Blast-1,BLAST1,BLAST,BCM1

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

27-220 aa

> 90% as determined by SDS-PAGE

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.