Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL4 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02567

Monokine with inflammatory and chemokinetic properties.

CCL4 Protein, Mouse, Recombinant (His)

CCL4 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02567
Monokine with inflammatory and chemokinetic properties.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$105-In Stock
10 μg$16920 days20 days
20 μg$283-In Stock
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Monokine with inflammatory and chemokinetic properties.
Species
Mouse
Expression System
E. coli
TagN-6xHis
Accession NumberP14097
Synonyms
Small-inducible cytokine A4,SIS-gamma,Scya4,Protein H400,Mip1b,Macrophage inflammatory protein 1-beta (MIP-1-beta),Immune activation protein 2 (ACT-2;ACT2),Ccl4,C-C motif chemokine 4
Amino Acid
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Construction
24-92 aa
Protein Purity
> 90% as determined by SDS-PAGE.
CCL4 Protein, Mouse, Recombinant (His)
Molecular Weight11.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Monokine with inflammatory and chemokinetic properties.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords