Monokine with inflammatory and chemokinetic properties.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 284.00 | |
100 μg | 20 days | $ 537.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Monokine with inflammatory and chemokinetic properties. |
Species | Mouse |
Expression System | E. coli |
Tag | N-terminal 6xHis-tagged |
Accession Number | P14097 |
Synonyms | Immune activation protein 2, SIS-gamma, Mip1b, MIP-1-beta, ACT-2, C-C motif chemokine 4, Small-inducible cytokine A4, Protein H400, ACT2, Macrophage inflammatory protein 1-beta, Ccl4, Scya4 |
Amino Acid | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 24-92 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 11.8 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Monokine with inflammatory and chemokinetic properties. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CCL4 Protein, Mouse, Recombinant (His) Immune activation protein 2 SIS-gamma Mip1b MIP-1-beta ACT-2 C-C motif chemokine 4 Small-inducible cytokine A4 Protein H400 ACT2 Macrophage inflammatory protein 1-beta Ccl4 Scya4 recombinant recombinant-proteins proteins protein