Home Tools
Log in
Cart

C1QTNF3 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02598
Synonyms: Secretory protein CORS26, C1QTNF3, Complement C1q tumor necrosis factor-related protein 3, Collagenous repeat-containing sequence 26 kDa protein, CTRP3, CORS26

C1QTNF3 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is Q9ES30.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
C1QTNF3 Protein, Mouse, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 614.00
100 μg 20 days $ 1,720.00
500 μg 20 days $ 5,170.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description C1QTNF3 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is Q9ES30.
Species Mouse
Expression System HEK293 Cells
Tag N-10xHis
Accession Number Q9ES30
Synonyms Secretory protein CORS26, C1QTNF3, Complement C1q tumor necrosis factor-related protein 3, Collagenous repeat-containing sequence 26 kDa protein, CTRP3, CORS26
Amino Acid QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Construction 23-246 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 26.6 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

C1QTNF3 Protein, Mouse, Recombinant (His) Secretory protein CORS26 C1QTNF3 Complement C1q tumor necrosis factor-related protein 3 Collagenous repeat-containing sequence 26 kDa protein CTRP3 CORS26 recombinant recombinant-proteins proteins protein

 

TargetMol