Home Tools
Log in
Cart

C1QTNF3 Protein, Human, Recombinant (His)

Catalog No. TMPH-01129
Synonyms: C1QTNF3, CORS26, Collagenous repeat-containing sequence 26 kDa protein, Secretory protein CORS26, Complement C1q tumor necrosis factor-related protein 3, CTRP3

C1QTNF3 Protein, Human, Recombinant (His) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
C1QTNF3 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description C1QTNF3 Protein, Human, Recombinant (His) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-6xHis
Accession Number Q9BXJ4
Synonyms C1QTNF3, CORS26, Collagenous repeat-containing sequence 26 kDa protein, Secretory protein CORS26, Complement C1q tumor necrosis factor-related protein 3, CTRP3
Amino Acid QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Construction 23-246 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 28.2 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

C1QTNF3 Protein, Human, Recombinant (His) C1QTNF3 CORS26 Collagenous repeat-containing sequence 26 kDa protein Secretory protein CORS26 Complement C1q tumor necrosis factor-related protein 3 CTRP3 recombinant recombinant-proteins proteins protein

 

TargetMol