Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

C1QTNF3 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01130 Copy Product Info
C1QTNF3 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

C1QTNF3 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01130
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

C1QTNF3 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

C1QTNF3 Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
C1QTNF3 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberQ9BXJ4
Synonyms
Secretory protein CORS26,CTRP3,Complement C1q tumor necrosis factor-related protein 3,Collagenous repeat-containing sequence 26 kDa protein (CORS26),C1QTNF3
Amino Acid
QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Construction
23-246 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords