Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Adiponectin Protein, Feline, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00350 Copy Product Info
Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30.

Adiponectin Protein, Feline, Recombinant

Catalog No. TMPH-00350
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30.

Adiponectin Protein, Feline, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$18520 days20 days
10 μg$29720 days20 days
20 μg$51520 days20 days
50 μg$71320 days20 days
100 μg$91620 days20 days
200 μg$1,26020 days20 days
500 μg$1,93020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30.
Species
Feline
Expression System
E. coli
TagTag Free
Accession NumberA4PB30
Synonyms
apM1
Amino Acid
QDSETEGPGVVVPLPKGACTGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGVTGIEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLESRVTVPNVPIRFTKIFYNQQNHYDVTTRKFHCNIPGLYYFSYHITVYLKDVKVSLYKRDKAMLFTYDQYQEKNVDQASGSVLLHLETGDEVWLQVYGDGDYNGLYADNVNDSTFTGFLLYYDTV
Construction
18-244 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords