Shopping Cart
- Remove All
- Your shopping cart is currently empty
TLN-58, an antimicrobial peptide, exhibits antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. It also promotes the upregulation of inflammatory cytokine mRNAs in normal human keratinocytes and NCL-SG3 cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | TLN-58, an antimicrobial peptide, exhibits antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. It also promotes the upregulation of inflammatory cytokine mRNAs in normal human keratinocytes and NCL-SG3 cells [1]. |
Molecular Weight | 6861.85 |
Formula | C305H498N92O86S |
Sequence | Thr-Leu-Asn-Gln-Ala-Arg-Gly-Ser-Phe-Asp-Ile-Ser-Cys-Asp-Lys-Asp-Asn-Lys-Arg-Phe-Ala-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
Sequence Short | TLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.