Shopping Cart
- Remove All
- Your shopping cart is currently empty
PSM-β, an active peptide isolated from Staphylococcus epidermidis, acts as an analog of staphylococcal toxins and is also known as a phenol-soluble modulin (PSM). PSM-β exhibits bacteriostatic properties and possesses minimal hemolytic activity [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PSM-β, an active peptide isolated from Staphylococcus epidermidis, acts as an analog of staphylococcal toxins and is also known as a phenol-soluble modulin (PSM). PSM-β exhibits bacteriostatic properties and possesses minimal hemolytic activity [1] [2]. |
Molecular Weight | 4639.28 |
Formula | C208H338N52O65S |
Sequence | Met-Ser-Lys-Leu-Ala-Glu-Ala-Ile-Ala-Asn-Thr-Val-Lys-Ala-Ala-Gln-Asp-Gln-Asp-Trp-Thr-Lys-Leu-Gly-Thr-Ser-Ile-Val-Asp-Ile-Val-Glu-Ser-Gly-Val-Ser-Val-Leu-Gly-Lys-Ile-Phe-Gly-Phe |
Sequence Short | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.