Shopping Cart
- Remove All
- Your shopping cart is currently empty
Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases cyclic GMP levels in the renal cortex and medulla, and enhances renal guanylate cyclase activity [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases cyclic GMP levels in the renal cortex and medulla, and enhances renal guanylate cyclase activity [1]. |
Molecular Weight | 3507.92 |
Formula | C152H236N38O51S3 |
Cas No. | 112160-82-4 |
Sequence | Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp |
Sequence Short | NPMYNAVSNADLMDFKNLLDHLEEKMPLED |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.