Shopping Cart
- Remove All
- Your shopping cart is currently empty
PHI-27 (rat) is a 27-amino acid peptide used to identify peptide hormones and other bioactive peptides [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PHI-27 (rat) is a 27-amino acid peptide used to identify peptide hormones and other bioactive peptides [1]. |
Molecular Weight | 3011.39 |
Formula | C136H216N36O41 |
Cas No. | 96849-38-6 |
Sequence Short | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.