Shopping Cart
- Remove All
- Your shopping cart is currently empty
Palicourein, a 37-amino-acid cyclic polypeptide, inhibits the in vitro cytopathic effects of HIV-1RF infection in CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Palicourein, a 37-amino-acid cyclic polypeptide, inhibits the in vitro cytopathic effects of HIV-1RF infection in CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM [1]. |
Molecular Weight | 3922.36 |
Formula | C159H250N48O56S6 |
Cas No. | 331714-57-9 |
Sequence | Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
Sequence Short | Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.